Horst D. Deckert

UNTERNEHMER-BERATER, SERIENUNTERNEHMER BZW. MEHRFACHGRÜNDER Parteilos und damit völlig unabhängig von irgendwelchen Parteien, Organisationen, Verbänden, etc. Seit 1971 im Dienst von Inhabern, Geschäftsführern, Unternehmern. 1971: Gründung einer Werbeagentur mit dem Schwerpunkt Marketing für Kleinbetriebe im Alter von 19 Jahren. Seit 1977 Firmengründer in Europa, USA und Südamerika. Fragen?
Kostenlos Termin buchen

Der nukleare Iran und Al-Kaida, die neuen Feinde der USA

Die Biden-Verwaltung hat neue Feinde gefunden.

Die New York Times versichert, dass der Iran nächste Woche eine Atombombe bauen könnte [1], während die Geheimdienstmitarbeiter dem Intelligence and National Security Summit versichert haben, dass al-Kaida sich erholt und im nächsten Jahr in der Lage sein wird, ebenso große Verluste wie am 11. September 2001 zu verursachen.

[1] « Iran Nears an Atomic Milestone », David Sanger & William Broad, The New York Times, September 14, 2021.

Dieser Beitrag ist unter Lizenz der Creative Commons

Sie können die Artikel des Réseau Voltaire frei vervielfältigen unter der Bedingung die Quellen anzuführen, ohne die Artikel zu verändern und ohne diese für kommerzielle Zwecke zu nutzen (Lizenz CC BY-NC-ND).

Quelle: „Der nukleare Iran und Al-Kaida, die neuen Feinde der USA“, Übersetzung Horst Frohlich, Voltaire Netzwerk, 16. September 2021, www.voltairenet.org/article214087.html


Die USA will also wieder gegen Al Qaida kämpfen… Dazu auch dieser Artikel zum 20. Jahrestag von 9/11:

Der Elfte September

Die False-Flag-Attacken vom 11.9.2001 und ihre Auswirkungen offenbaren den blanken Rassismus der Westlichen Wertegemeinschaft und ihren Kampf gegen Wissenschaft und Aufklärung.

Vor zwanzig Jahren zog sich die US-Regierung einen Freifahrtschein für einen „War on Terror“, mit dem der Erdball vor allem im globalen Süden überzogen wurde und der Millionen Ausländern den Tod brachte. An der Heimatfront und bei den Verbündeten wurden die eigenen Bürger zurechtgestutzt und „eingedost“. Dass die offizielle Story zu den vorgeblich von der Terrororganisation Al Qaida unter ihrem Führer Osama bin Laden durchgeführten Anschlägen in den USA nicht nur voll von Widersprüchen, sondern für jeden Menschen, der einigermaßen bei Verstand und guten Willens ist, klar als „Bullshit“ zu identifizieren ist, aber trotzdem durchgesetzt wird, scheint für viele der selbsternannten Herren der Menschheit eher ein befriedigender Potenzbeweis als ein Problem zu sein. Wer in der Coronakrise sagt „aber, aber, das würden die doch niemals tun“, der sieht bei 9/11 deutlich, dass sie es tun und schon getan haben, wenn auch auf etwas niedrigerem Level.

Gleich eingangs soll hier an einem einfachen und für jeden klar verständlichen Beispiel gezeigt werden, dass die offizielle Geschichte des Elften Septembers falsch ist und US-Regierung und Co Täter sind und keine Opfer. Wer nach Ansicht der Bilder der offiziellen Einschlagstelle am Pentagon, dem Sitz des US-Verteidigungsministeriums, immer noch behauptet, bei Kritikern der amtlichen 9/11-Theorie handele es sich um Spinner oder Antisemiten, und jegliche Diskussion ablehnt, der spuckt auf die Grundlagen der Physik und den Menschenverstand und will vielleicht einen Kampf gewinnen, in dem er sich wähnt, aber sicher keine Aufklärung der wirklichen Umstände betreiben.

Bild 1: Amtliche Boeing-757-Einschlagsstelle in Arlington am Pentagon bei 9/11. Foto oben rechts: Direkt nach dem Einschlag, US Navy (1). Foto links: Kurz vor dem Zusammensturz mit offizieller „quadratischer“ Einschlagstelle in der unteren Mitte des Bildes, US Marine Corps, Wikimedia (2). Foto unten rechts: Nach dem Zusammenbruch, US Air Force, Wikipedia (3).

Schon ein Blick auf die vermeintliche Pentagon-Einschlagstelle in Arlington zeigt, dass hier kein Passagierflugzeug von ungefähr 50 Meter Länge mit einer Flügelspannweite von 38 Metern und einem Gewicht von über 100000 Kilogramm plus zehntausender Liter Treibstoff – der Flug sollte nach Los Angeles gehen – ein kleines Mauerloch verursacht hat, und das, ohne die umliegenden Fenster zu beschädigen. Auf dem US-Navy-History-Foto oben rechts, das die Situation direkt nach dem Einschlag zeigt, sieht das Verhalten der umstehenden Personen eigentlich eher nach einer Übung samt Evakuierung als nach katastrophalem Ernstfall aus. Den offiziellen Angaben zufolge sind hier gerade alleine am Boden, ohne Flugzeuginsassen, 125 Menschen gestorben – oder liegen zu diesem Zeitpunkt noch im Sterben (4). Das Foto links zeigt die Situation später, kurz vor dem Gebäude-Zusammensturz, samt offizieller „quadratischer“ Einschlagstelle. Das Foto unten rechts zeigt diese Stelle später während der Bergungsarbeiten, nach dem Zusammenbruch dieses Gebäudeteils.

Bild 2: Rechts die offizielle schräge Anflugroute des Verkehrsflugzeuges auf das Pentagon, Grafik der US Navy (5). Links ein Foto der US Army mit „geradem Schadensbild“, Aufnahme nach dem Einbrechen der Obergeschosse (6).

Da im Bereich der angeblichen Katastrophenstelle der frontale Anflug auf das Pentagon-Gebäude für ein Flugzeug im Tiefflug so gar nicht möglich – da verbaut – ist, musste man sich hinsichtlich der vermeintlichen Anflugroute des Flugzeuges etwas einfallen lassen und hat die hier oben im Bild rechts zu sehende Grafik veröffentlicht, welche die offizielle Anflugroute der Boeing-757 zeigt: Schräg ins Gemäuer, gerade noch so an dem Generator vorbei, der neben den Baucontainern steht. Dass dieser „schräge Vogel“ dem Vergleich mit der Realität nicht standhält, zeigen die oben gezeigten Fotos der offiziellen Impact-Stelle. Man beachte auch die beeindruckende Stabilität der Mauern links, die dem angeblich schräg in sie rein einschlagenden Flugzeug genauso gut standhielten wie die Fenster über der „Einschlagstelle der Boeing 757“.

Wissenschaft, Aber-Aber-Ritual und Antisemitismus

Beliebt als „Angriffswerkzeug“ nach dem Verweis auf solche Bilder ist die Unterstellung, man würde behaupten, in die beiden WTC-Türme in New York seien ja gar keine Flugzeuge eingeschlagen. „Aber, aber, ich habe doch mit eigenen Augen die Flugzeuge in die Türme einschlagen sehen!“ heißt es dann, einhergehend mit der stillschweigenden, aber druckvollen Behauptung, der Kritiker sei ein Spinner. Nur ist es eben so, dass bei den Anschlagsstellen in New York im Wesentlichen die Art und Weise des Zusammenbruchs der Zwillingstürme Stunden nach den Einschlägen kritisiert wird, der nach Art einer geplanten Sprengung ablief, und darüber hinaus der Zusammenbruch beziehungsweise die Sprengung eines weiteren Turms neben diesen beiden Türmen, WTC-7, in den kein Flugzeug flog. Die wirkliche wissenschaftliche Antwort auf diese Unterstellung, die ja de facto ein Ablenkungsmanöver ist, und sei es aus Verzweiflung, weil man die Realität nicht wahrhaben will oder geschockt ist, ist aber, dass die Ereignisse in New York hier gar nicht relevant sind. Bricht eine Säule der offiziellen Theorie zusammen, bricht alles zusammen. Das nennt man Wissenschaft. Es wird doch nicht eine Lüge dadurch geheilt, dass man an einer anderen Stelle – vermeintlich – Recht hat. So funktioniert das nicht. Man kann nicht einfach so lange ein „Aber-Aber-Ritual“ durchführen, bis das Gegenüber – vermeintlich – keine Antwort mehr hat, indem es beispielsweise an der Forderung gescheitert ist, alle Schuhgrößen der damaligen Hausmeister der WTC-Türme auswendig und korrekt Personen zugeordnet aufzusagen, nur um dann selbst halb im Wahn zu brüllen „Ha, ich hatte doch recht! Stimmt ja gar nicht! Stimmt ja gar nicht!“. Was hier spaßeshalber etwas übertrieben dargestellt wurde, findet vom Grundprinzip her ständig statt, hat aber mit Wissenschaft und Aufklärung nichts zu tun.

Eine beliebte Waffe gegen Wissenschaftler und andere Zweifler ist neben dem Propagandaclaim „irrer Verschwörungstheoretiker“ und dem Aber-Aber-Ritual der – haltlose – Antisemitismusvorwurf. Selbstverständlich gibt es keinen wissenschaftlichen Zusammenhang zwischen der Forderung nach einer naturwissenschaftlich-physikalischen Betrachtung von Ereignissen und Hass auf Juden. Das ist doch völlig irrwitzig. Vor dem zwanzigsten Jahrestag der 9/11-Terrorangriffe kann man allerdings in den Medien Folgendes finden:

Bild 3: Links der Tagesspiegel (7), rechts der NDR zu 9/11 und Antisemitismus (8).

Der Berliner Tagesspiegel schreibt am 10.9.2021:

„Antisemitismus und Fake News: Wie sich Verschwörungstheorien nach 9/11 unter Berliner Jugendlichen ausbreiteten. Immer wenn etwas Böses passiert, wird nach Sündenböcken und alternativen Fakten gesucht. Woher Verschwörungsmythen nach 9/11 kamen und wer sie weiterverbreitet hat.“

Beim ARD-Sender NDR heißt es zur Sendung ZAPP vom 8.9.2021:

„9/11 und Verschwörungstheorien: 20 Jahre danach. 20 Jahre nach dem 11. September 2001 werden noch immer krude Verschwörungsmythen über die Attentate verbreitet: in sozialen Medien, Dokus oder im Deutschrap. Stets werden darin Schuldige ausgemacht – und zwar keine islamistischen Terroristen. Mal steckt angeblich die US-Regierung dahinter, mal eine ‚jüdische Weltverschwörung‘. Was macht das mit den Hinterbliebenen? Welche Folgen hat das für Jüdinnen und Juden, die mit diesen oft antisemitischen Verschwörungsnarrativen angefeindet werden? Und welche Verantwortung tragen die Plattformbetreiber, die solche Inhalte zur Verfügung stellen?“

Der Antisemitismusvorwurf gegen Kritiker offizieller Narrative wird mittlerweile im Prinzip beliebig eingesetzt, wie nicht nur bei 9/11, sondern vor auch in der Coronakrise und bei anderen Themen zu beobachten ist. Dabei macht die Antisemitismusverleumdung nicht einmal vor Juden halt (9). So musste sich beispielsweise die kürzlich verstorbene Auschwitz-Überlebende und überzeugte Antifaschistin Esther Bejarano von nicht-jüdischem deutschen „Jungvolk“ als Antisemitin beschimpfen lassen, weil sie dessen Ansichten nicht teilte, und Moshe Zuckermann, Professor für Geschichte und Philosophie sowie jüdischer Sohn von Holocaust-Überlebenden, erleidet das gleiche Schicksal, wie er in einem Interview berichtet (10, 11). Bei den verleumdenden Personen handelt es sich im Wesentlichen um die gleichen Pseudolinken, die sich heute in der Coronakrise für Machteliten-Politik prügeln wollen, und keine tatsächlichen Linken, sondern eher dauerbeleidigte Wohlstandskinder darstellen. Ein wesentlicher Teil dieser lautstarken Gruppen sind sich selbst als „Antideutsche“ betitelnde Personen, die eben auch, zusätzlich zu einigen Journalisten, Politikern etc., beim Thema 9/11 aktiv sind. Der Schutz der westlichen Machteliten ist für sie gleichbedeutend mit „Kampf gegen Antisemitismus“. Einen ungefähren Einblick in diese „Denkweise“ erlaubt ein Auszug aus einem Interview bei Neues Deutschland vom November 2014 mit der in antideutschen Kreisen äußerst beliebten Band „Antilopengang“, die von der Band Die Toten Hosen – gefallene Punkrock-Helden mit Hang zur Merkel-Verehrung – stark gefördert wird (12, 13):

„Danger Dan: Also Blockupy fand‘ ich schon besonders dumm. Diese Idee es gäbe irgendwie 99% von Unterdrückten, die von einem Prozent Reicher unterdrückt werden – ein besseres Beispiel für verkürzte Kapitalismuskritik gibt’s eigentlich gar nicht. Da würde auch die NPD unterschreiben und mitmachen.

Koljah: Das ist ja auch schon fast Antisemitismus. Da ist ja schon der Aufruf zum Pogrom impliziert.

Danger Dan: Das das überhaupt noch geht, dass Linke sich auf so einen Unsinn einigen können, hat mich krass verwundert. Da bin ich dann doch sehr froh über Rechtsstaatlichkeit, über Polizisten, die diese Leute dann im Zaum halten. Und ich würde auch tatsächlich, wenn diese Leute sich erheben und das umsetzen wollen, was da zwischen den Zeilen angekündigt wird, dieses reiche eine Prozent – wer auch immer das sein soll – wenn die die jetzt lynchen würden, würde ich auch auf der Seite der Polizei gegen sie kämpfen. Mit Waffengewalt.

Koljah: Ich muss sagen: mich hat’s überhaupt nicht verwundert. Sondern das steht in der Tradition einer Linken, die in Deutschland spätestens seit 68 antisemitisch durchsetzt ist. Das passt dazu. Diese ganzen Proteste, die so tun als könne man nur »das Finanzkapital« kritisieren, die ein Bild von »guter Kapitalismus gegen schlechter Kapitalismus« zeichnen, bieten genau den Anknüpfungspunkt für Antisemitismus. […]

Danger Dan: Da wo solche abstrakten Probleme auf irgendwelche Minderheiten oder am Ende noch die Juden projiziert werden, bin ich aus dem Spiel raus und hab keine Lust darauf. Ich bin dann sehr skeptisch und bei mir gehen die Alarmglocken an. Und im Fall von Antisemitismus sind Juden die, die als Juden angegriffen werden. Das hat nichts mit Religion zu tun.“

Bizarre Claims

Eingangs wurde bereits aufgezeigt, dass die amtliche Verschwörungstheorie von Osama bin Laden, der aus einer Höhle in Afghanistan heraus neunzehn mit Teppichmessern bewaffnete Islamisten dirigierte, die in den USA vier Flugzeuge kaperten und damit die 9/11-Anschläge begingen, nicht haltbar ist. Auch das „Loch von Shanksville“ zeigt dies noch einmal deutlich auf. Hier war wie in Arlington am Pentagon ebenfalls kein Flugzeug am Werk:

Bild 4: Offizielle Absturzstelle von Flug 93 auf dem Feld in Shanksville, Pennsylvania, 11. September 2001. Der links in Großaufnahme zu sehende Krater ist im rechten unteren Foto genau in der Mitte zu sehen. Die beiden Fotos wurden von US-Behörden hergestellt und sind Public Domain, beispielsweise bei Wikipedia und Wikimedia erhältlich (14, 15, 16). Rechts oben das „Shanksville-Flugzeug“ drei Tage vor seiner Entführung, Wikipedia (17).

Wie jeder sehen kann, zeigen die beiden offiziellen Fotos der 9/11-Shanksville-„Absturzstelle“, dass dort kein großes Verkehrsflugzeug abgestürzt ist. Man sieht einen kleinen Einschlagskrater von vielleicht gerade Mal fünf Metern Durchmesser. Man beachte die Fahrzeuge und Bäume im rechten unteren Bild und vergleiche das mit dem kleinen Krater in der Mitte dieses Fotos. Man beachte die beiden Menschen mit den weißen Hosen, die neben dem links in Großaufnahme zu sehenden Krater stehen. Dieses Mini-Loch kann niemals die Einschlagstelle einer Passagiermaschine sein.

Dass an der ganzen 9/11-Story etwas faul ist, hätte man sich allerdings auch ohne die gezeigten Bilder bereits denken können. Die Kurzfassung:

1. USA gründet Al Qaida („Mudschaheddin“) – sagt selbst Hillary Clinton (18).

2. „Al Qaida“ begeht laut USA 9/11-Anschläge (3000 Tote) in 2001 in USA (19).

3. USA und Al Qaida überfallen gemeinsam Syrien (seit 2011), Libyen, Yemen…(20)

Die Figur „Osama bin Laden“ taucht nicht erst mit den Anschlägen in den USA auf der Bildfläche auf. Osama bin Laden war vorher ganz offiziell „unser Mann in Afghanistan“, wo er als Führer der Qaida für die US-Amerikaner gegen die sowjetischen und afghanischen Truppen kämpfte (21). Es gibt da dieses berühmte Foto von Bin Laden in einem nicht weniger berühmten Artikel der britischen Zeitung Independent aus dem Jahre 1993, der den amtlichen Terroristenchef als unseren Helden im Kampf gegen die Sowjetunion in Afghanistan feiert.

Bild 5: Foto des Independent-Artikels zu Bin Laden (22).

Der Independent hat mittlerweile das Bin-Laden-Foto aus der Onlineversion des Artikels entfernt („Photograph omitted“). In dem Artikel mit der Überschrift „Anti-Soviet warrior puts his army on the road to peace: The Saudi businessman who recruited mujahedin now uses them for large-scale building projects in Sudan. Robert Fisk met him in Almatig“ von 1993 geht es um die – angebliche – Zeit der Figur Bin Laden nach dem Kampf seiner Mudschaheddin-Jihadisten – später als „Al Qaida“ tituliert – gegen die sowjetische Armee in Afghanistan: Er hielt sich danach laut Independent-Artikel im Sudan auf und soll sich dort im Straßenbau verdient gemacht haben (22).

Als 2016 im Syrienkrieg der Kampf der syrischen Truppen gegen die die prowestlichen Besatzer von Aleppo anstand, konnte man einen Sprecher des US-Verteidigungsministeriums folgendes sagen hören (23):

“That said, it’s primarily al-Nusra who holds Aleppo”

Al Nusra ist der in Syrien tätige Arm der Al Qaida und das bestreitet weder Freund noch Feind. Mittlerweile wurde Al Nusra umbenannt etc.. Die Qaida – „Rebellen“ genannt – hielt also nach Angaben des US-Militärs Aleppo beziehungsweise Ost-Aleppo, vom Westen unterstützt und mit Waffen beliefert. Bekannt war das schon lange vor der hier zitierten Aussage und blitzte auch schon Mal bei TagesschauSpiegel und Co durch (24, 25, 26).

al_kaida_christoph_sydow_spiegel

Bild 6: Screenshot aus Spiegel Online, hoffen auf Al-Qaida-Truppennachschub (26, 27).

An diesem Punkt stellt sich doch jedem, der klar bei Verstand ist, die Frage, wie es denn bitte sein kann, dass man als US-Regierung beziehungsweise Westliche Wertegemeinschaft auch nur in Erwägung zieht, mit Al Qaida zu kämpfen beziehungsweise diese einzusetzen, geschweige denn, dies tatsächlich wenige Jahre nach den vorgeblichen Jahrhundertanschlägen der Al Qaida in den USA auch zu tun. 2011 begann der als „syrischer Bürgerkrieg“ getarnte Angriff auf Syrien, unter anderem mit ausländischen Kämpfern von Al Qaida, und quasi parallel dazu hat man ganz offiziell die Figur Osama bin Laden entsorgt, der den amtlichen Angaben zufolge am 2. Mai 2011 in Pakistan nicht etwa festgenommen, sondern getötet wurde, und dessen Leiche man leider direkt entsorgt hat… Wikipedia schreibt zu Letzterem (28):

„Bin Ladens Identität wurde nach Angaben der US-Regierung mit einer DNA-Analyse festgestellt und sein Leichnam noch am 2. Mai 2011 an geheimer Stelle von Bord des US-Flugzeugträgers USS Carl Vinson im Arabischen Meer bestattet.“

Ein neues blutiges Jahrhundert, im Notstand

Der Nationale Notstand in den USA, der aufgrund der „9/11-Al-Qaida-Angriffe“ erlassen wurde, wird seit 20 Jahren jedes Jahr vom jeweiligen US-Präsidenten verlängert. Bush, Obama, Trump und jetzt Biden am 9. September 2021 (29): Sie alle verlängerten immer wieder ihre Notstandsbefugnisse in einer „Notice on the Continuation of the National Emergency with Respect to Certain Terrorist Attacks“.

Der „War on Terror“ seit 2001 hat außerhalb des Westens Millionen Menschenleben gekostet, die bei den Führern und Aktivisten der Westlichen Wertegemeinschaft keine Bedeutung zu haben scheinen. Der blanke Rassismus. Dazu hat man noch ein paar hundert Unschuldige eingefangen, die selbstverständlich mit den Terrorattacken von 9/11 nichts zu tun haben können, wie wir bereits eingangs mit der Aufdeckung des False-Flag-Charakters der Anschläge gesehen haben, und hat sie zum demonstrativen Durchfoltern in Guantanamo oder zur heimlichen Folter an noch finstereren Orten eingekerkert. Einige sitzen da heute noch. Alles offenbar „scheißegal“. Der blanke Rassismus. Der Gefangene Ahmed Rabbani hat Anfang 2021 einen Brief an US-Präsident Biden geschrieben, aus dem hier ein kleiner Auszug zitiert werden soll (30, 31):

„Als ich 2002 in Karachi gekidnappt wurde und an die CIA für ein Kopfgeld verkauft wurde mit einer falschen Story, dass ich ein Terrorist namens Hassan Gul sei. Meine Frau und ich hatten gerade die gute Auskunft bekommen, dass sie schwanger war. Ein paar Monate später gebar sie meinen Sohn Jawad. Mir wurde niemals erlaubt, mein eigenes Kind zu sehen. Präsident Biden ist ein Mann, der von der Bedeutung der Familie spricht. Ich frage mich, ob er sich vorstellen kann, was es bedeutet, niemals den eigenen Sohn berührt zu haben. Meiner wird bald 18 Jahre alt sein und ich bin nicht dort gewesen, um ihm zu helfen oder ihn zu leiten. (…)

Der Bericht des Geheimdienstausschusses des Senats über die CIA-Folter wurde ‚unter seiner Aufsicht‘ 2014 abgeschlossen, wie man sagt. Es ist ein Report, in dem ich vorkomme. Darin steht, dass ich 540 Tage gefoltert wurde in einem ‚Dunkel-Gefängnis‘ in Afghanistan ‚ohne Erlaubnis‘ – ob das besser oder schlechter ist, kann ich nicht entscheiden

Ich kann bestätigen, dass die Folter stattfand, obwohl ich die Tage und Nächte nicht selbst zählen konnte: die Tage und Nächte flossen zu einem Block zusammen, als ich in einer finsteren Grube an einer Stange aufgehängt war und mir die Arme unter Qualen aus den Schultern auskugelten.

Ich zweifle, ob Präsident Biden verstehen kann, was diese Folter bedeutet; eine Frau im Nebenraum schreien zu hören und einem gesagt wird, dass es deine Frau ist, und dass, wenn ich nicht tue, was sie sagen, sie vergewaltigt oder getötet wird.“

Türme und noch ein Einsturz

Jetzt sind wir am Ende des Artikels angelangt und der Einsturz der drei Türme in New York, nachdem zwei davon von Flugzeugen getroffen wurden, der immer so im Fokus steht, wurde gar nicht behandelt. Man muss das auch nicht, um nachzuweisen, dass die Geschichte der US-Regierung zu 9/11 nicht stimmt, wie wir gleich eingangs gesehen haben. Für Interessierte gibt es allerdings genug Material, das aufzeigt, dass die Türme nur gesprengt worden sein können und nicht einfach so zusammengebrochen sind. Glücklicherweise haben sich auch einige aufrechte Physiker und Ingenieure des Themas angenommen und die Sache überprüft und durchgerechnet. Im Prinzip kann aber jeder Amateur schon beim Anschauen der Fall-Videos von WTC-1, WTC-2 und WTC-7 leicht erkennen, dass das jeweils einer Abbruchsprengung eines Hochhauses verdammt ähnlich sieht und dass die Wolkenkratzer fast im freien Fall, ohne Widerstand, zu Boden rauschen, was eben nur durch eine Sprengung möglich ist, wie auch immer diese technisch durchgeführt wurde. Die völlig ausgebrannten Hochhäuser in London und Peking, die im Gegensatz zu dem mit einem Stockwerksbrand „ausgestatteten“ WTC-7 einfach stehengeblieben sind, dürfte wohl auch jeder kennen…(32, 33)

Die offizielle „Theorie“ zu 9/11 ist längst eingestürzt, man muss die Nachricht davon nur noch verbreiten (34-52). Wer dahingehend noch zaudert, dem sei zur Entscheidungsfindung höflichst ein kleines Gedankenspiel empfohlen: Stellen Sie sich vor, Sie würden Ahmed Rabbani bei einem Besuch in Guantanamo Bay gegenüberstehen und sollten ihm erklären, dass sie keine Texte zur Aufklärung von 9/11 weiterverbreiten wollten, weil Sie Angst hatten, dass Sie bei Verbreitung solcher Aussagen vielleicht irgendwann einmal eine Facebook-Sperre hätten bekommen können.

Links

(1) https://www.history.navy.mil/content/history/nhhc/research/library/online-reading-room/title-list-alphabetically/p/pentagon-9-11-footnotes/_jcr_content/body/image_14.img.jpg/1438613592644.jpg
(2) https://commons.wikimedia.org/wiki/File:DM-SD-02-03880.JPEG
(3) https://en.wikipedia.org/wiki/File:Aerial_view_of_the_Pentagon_during_rescue_operations_post-September_11_attack.JPEG
(4) https://en.wikipedia.org/wiki/Victims_of_Terrorist_Attack_on_the_Pentagon_Memorial
(5) https://www.history.navy.mil/content/dam/nhhc/research/library/online-reading-room/pentagon911/pentagon_911-8.jpg
(6) http://blauerbote.com/wp-content/uploads/2021/09/army_mil_pentagon.jpg
(7) https://plus.tagesspiegel.de/berlin/antisemitismus-und-fake-news-wie-sich-verschwoerungstheorien-nach-911-unter-berliner-jugendlichen-ausbreiteten-243077.html
(8) https://www.ndr.de/fernsehen/sendungen/zapp/9-11-und-Verschwoerungstheorien-20-Jahre-danach,gefaehrlichemyth100.html
(9) https://projektkritischeaufklaerung.de/de/konferenz-in-berlin-am-10-februar-2018/
(10) http://blauerbote.com/2021/08/11/dokumentarfilm-zeit-der-verleumder-mit-moshe-zuckermann-rolf-becker-jackie-walker-ali-abunimah-moshe-machover-judith-bernstein-esther-bejarano-u-a/
(11) https://odysee.com/@Punkt.PRERADOVIC:f/Zuckermann:4
(12) http://blauerbote.com/2021/08/02/die-machteliten-die-toten-afrikaner-und-die-absicherung-der-herren-durch-beleidigte-wohlstandskinder/
(13) https://www.nd-aktuell.de/artikel/951837.punk-hat-viele-widerspruechliche-inhalte.html
(14) https://fr.m.wikipedia.org/wiki/Fichier:Flight_93_Crater.jpg
(15) http://blauerbote.com/wp-content/uploads/2019/11/flight_93_crash_crater_911_shanksville_pennsylvania_september11_united_airlines_usa_2001_terror.png
(16) https://commons.wikimedia.org/wiki/File:Flight93Crash.jpg
(17) https://en.wikipedia.org/wiki/United_Airlines_Flight_93#/media/File:N591UA.jpg
(18) http://blauerbote.com/2018/07/27/noam-chomsky-hillary-clinton-we-created-al-qaeda-isis/
(19) http://blauerbote.com/2019/09/20/was-ist-911/
(20) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(21) http://blauerbote.com/2018/10/08/zbigniew-brzezinski-afghanistan-al-qaida-und-osama-bin-laden/
(22) http://www.independent.co.uk/news/world/anti-soviet-warrior-puts-his-army-on-the-road-to-peace-the-saudi-businessman-who-recruited-mujahedin-1465715.html
(23) http://www.defense.gov/News/Transcripts/Transcript-View/Article/739157/department-of-defense-press-briefing-by-col-warren-via-teleconference-from-bagh
(24) http://blauerbote.com/2017/03/18/syrien-ost-aleppo-wurde-von-al-qaida-beherrscht/
(25) http://blauerbote.com/2018/09/05/laut-usa-und-tagesschau-handelt-es-sich-bei-den-rebellen-in-syrien-um-al-qaida/
(26) http://blauerbote.com/2016/08/02/der-spiegel-feuert-al-kaida-an-die-islamisten-sind-aleppos-letzte-hoffnung/
(27) https://www.spiegel.de/politik/ausland/syrien-die-islamisten-sind-aleppos-letzte-hoffnung-a-1105806.html
(28) https://de.wikipedia.org/wiki/Osama_bin_Laden
(29) https://www.whitehouse.gov/briefing-room/presidential-actions/2021/09/09/notice-on-the-continuation-of-the-national-emergency-with-respect-to-certain-terrorist-attacks/
(30) https://einarschlereth.blogspot.com/2021/02/ich-bin-ein-gefangener-in-guantanamo.html
(31) http://blauerbote.com/2021/02/05/ich-bin-ein-gefangener-in-guantanamo-bay-und-ich-habe-eine-botschaft-fuer-praesident-biden/
(32) http://blauerbote.com/2017/06/14/hochhausbrand-in-london-vs-wtc7-einsturz-bei-911/
(33) https://www.rubikon.news/artikel/20-jahre-terrorluge
(34) http://blauerbote.com/2021/09/09/118-augenzeugen-zu-9-11-das-zeugnis-der-feuerwehrleute-zu-den-explosionen-in-den-zwillingstuermen/
(35) https://www.rubikon.news/artikel/der-verklarte-tag
(36) https://www.rubikon.news/artikel/die-jahrhundertluge
(37) http://blauerbote.com/2016/09/05/physiker-fachblatt-zu-911-world-trade-center-einsturz-durch-kontrollierte-sprengung/
(38) https://www.europhysicsnews.org/articles/epn/pdf/2016/04/epn2016474p21.pdf
(39) https://www.rubikon.news/artikel/die-sprengung
(40) https://kenfm.de/akademische-naivitaet-und-der-11-september/
(41) https://www.amazon.de/Stigmatisierung-statt-Aufkl%C3%A4rung-%C2%BBVerschw%C3%B6rungstheorie%C2%AB-kontrafaktischen/dp/3862420019
(42) https://www.rubikon.news/artikel/selektive-wahrheitssuche
(43) https://www.rubikon.news/artikel/selektive-wahrheitssuche-2
(44) https://www.rubikon.news/artikel/der-pentagon-fake
(45) https://www.rubikon.news/artikel/der-scheinheilige-2
(46) https://www.radio-utopie.de/2016/09/10/15-jahre-terrorkrieg-und-11-september-wie-alles-begann/
(47) https://www.broeckers.com/911-2/
(48) https://www.rubikon.news/artikel/bilanz-eines-jahrhundertverbrechens
(49) http://antikrieg.com/aktuell/2019_08_08_dasverbrechen.htm
(50) http://blauerbote.com/2021/04/08/der-911-verschwoerungswahn/
(51) https://www.broeckers.com/2021/08/06/mythos-9-11-alles-klar-herr-kommissar/
(52) https://www.buchkomplizen.de/buecher-mehr/mythos-9-11.html

Ähnliche Nachrichten

Auch lesen x